DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Mst1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_038936729.1 Gene:Mst1 / 24566 RGDID:3114 Length:747 Species:Rattus norvegicus


Alignment Length:292 Identity:83/292 - (28%)
Similarity:131/292 - (44%) Gaps:35/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 DPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHE 93
            |||.:.:..|..|...  |...|||.|.|..::....||.       :.:.|.|:|||..   ..
  Rat   475 DPETLFDYCALKRCDD--DQPPSILDPPVQVQFEKCGKRV-------DQSNRLRVVGGHP---GN 527

  Fly    94 YPWMIMLM-WFGNFYCGASLVNDQYALTAAHCVNGFYHRL----ITVRLLEHNRQDSHVKIVDRR 153
            .||.:.|. ..|..:||.|||.:|:.|||..|:...:..|    :.:..:..|.|.....:....
  Rat   528 SPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCIWSCHDPLTGYEVWLGTINQNPQPGEANLQRVS 592

  Fly   154 VSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYA---GQTAVVTGWGALSEG 215
            |::.:..|.      .|.:.|::...||.|...:..:|:  |.|.|.   |....:.|||. |:|
  Rat   593 VAKTVCGPA------GSQLVLLKLERPVILNHHVARICL--PPEQYVVPPGTNCEIAGWGE-SKG 648

  Fly   216 GPISDTLQEVEVPILSQEECRNSNYGESKITDNMICA-GYVEQGGKDSCQGDSGGPMHVLGSGDA 279
            ...|..|...::.::|.:|| |..| ..::.::.||. |.:...|  :|:||.|||: ...:.|.
  Rat   649 TSNSTVLHVAKMKVISSQEC-NVKY-RRRVQESEICTEGLLAPTG--ACEGDYGGPL-ACYTHDC 708

  Fly   280 YQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            :.|.|::.....||:|..|.::|||..|.|||
  Rat   709 WVLQGLIIPNRVCARPRWPAIFTRVSVFVDWI 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 67/237 (28%)
Tryp_SPc 83..314 CDD:238113 68/238 (29%)
Mst1XP_038936729.1 PAN_1 32..111 CDD:394981
KR 116..196 CDD:214527
KR 199..276 CDD:214527
KR 321..403 CDD:214527
KR 408..490 CDD:214527 5/14 (36%)
Tryp_SPc 520..743 CDD:238113 68/238 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.