DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Hp

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_036714.2 Gene:Hp / 24464 RGDID:2825 Length:347 Species:Rattus norvegicus


Alignment Length:354 Identity:85/354 - (24%)
Similarity:139/354 - (39%) Gaps:87/354 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ATALGDLACATP--------------------SLRSASDPEKILNNLAQLRQSSFLDWIQSILGP 55
            ||.:.|.:|..|                    .|::..|....||:..|        |:....|.
  Rat    25 ATDIEDDSCPKPPEIANGYVEHLVRYRCRQFYKLQTEGDGIYTLNSEKQ--------WVNPAAGD 81

  Fly    56 EVPAEWSSPAKRECAECSCGN----INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQ 116
            ::|         :| |..||.    ::...||:||.......:||...::.......||:|::||
  Rat    82 KLP---------KC-EAVCGKPKHPVDQVQRIIGGSMDAKGSFPWQAKMISRHGLTTGATLISDQ 136

  Fly   117 YALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDR-----------RVSRVLIHPKYSTRNFDS 170
            :.||.|.  |.|         |.|:...:...|...           .:.:|::||:.|.    .
  Rat   137 WLLTTAQ--NLF---------LNHSENATAKDIAPTLTLYVGKNQLVEIEKVVLHPERSV----V 186

  Fly   171 DIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC 235
            ||.||:..:.|.:...:.|:|:|:......|:...|:|||. :.....::.|:.|.:|:..||:|
  Rat   187 DIGLIKLKQKVLVTEKVMPICLPSKDYVAPGRMGYVSGWGR-NVNFRFTERLKYVMLPVADQEKC 250

  Fly   236 ----RNSNYGESK-----------ITDNMICAGYVEQGGKDSCQGDSGGPMHVLGS-GDAYQLAG 284
                ..|...|.|           :..:..|||..:. .:|:|.||:|....|..: .|.:..||
  Rat   251 ELHYEKSTVPEKKGAVSPVGVQPILNKHTFCAGLTKY-EEDTCYGDAGSAFAVHDTEEDTWYAAG 314

  Fly   285 IVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            |:|:.:.||.... |||.|.....||:.|
  Rat   315 ILSFDKSCAVAEY-GVYVRATDLKDWVQE 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 66/255 (26%)
Tryp_SPc 83..314 CDD:238113 67/258 (26%)
HpNP_036714.2 CCP 33..87 CDD:153056 11/71 (15%)
Tryp_SPc 102..340 CDD:214473 66/255 (26%)
Tryp_SPc 103..343 CDD:238113 67/258 (26%)
Interaction with CD163. /evidence=ECO:0000250 259..264 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.