DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Hgf

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_058713.1 Gene:Hgf / 24446 RGDID:2794 Length:728 Species:Rattus norvegicus


Alignment Length:282 Identity:67/282 - (23%)
Similarity:123/282 - (43%) Gaps:45/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PEVPAEWSSPAKRECAECSCGNINTRH-----------RIVGGQETEVHEYPWMIMLMWFGNFYC 108
            |.||.:: .|..|...:.:...:|..|           |:|.|..|:. ...||:.|.:.....|
  Rat   458 PLVPWDY-CPISRCEGDTTPTIVNLDHPVISCAKTKQLRVVNGIPTQT-TVGWMVSLKYRNKHIC 520

  Fly   109 GASLVNDQYALTAAHCVNG------FYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRN 167
            |.||:.:.:.|||..|...      .|...:.:..:....::...:|::  :|:::..|:     
  Rat   521 GGSLIKESWVLTARQCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILN--ISQLVYGPE----- 578

  Fly   168 FDSDIALIRFNEPVRLGIDMHPVCMPT-----PSENYAGQTAVVTGW---GALSEGGPISDTLQE 224
             .||:.|::...|..|...:..:.:|:     |.:.    |..:.||   |.::..|    .|:.
  Rat   579 -GSDLVLLKLARPAILDNFVSTIDLPSYGCTIPEKT----TCSIYGWGYTGLINADG----LLRV 634

  Fly   225 VEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG 289
            ..:.|:..|:|...:.|:..:.::.:||| .|:.|...|:||.|||: :........:.|::..|
  Rat   635 AHLYIMGNEKCSQHHQGKVTLNESELCAG-AEKIGSGPCEGDYGGPL-ICEQHKMRMVLGVIVPG 697

  Fly   290 EGCAKPNAPGVYTRVGSFNDWI 311
            .|||.||.||::.||..:..||
  Rat   698 RGCAIPNRPGIFVRVAYYAKWI 719

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 58/242 (24%)
Tryp_SPc 83..314 CDD:238113 59/243 (24%)
HgfNP_058713.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527
KR 211..289 CDD:214527
KR 305..385 CDD:214527
KR 389..471 CDD:238056 5/13 (38%)
Tryp_SPc 495..719 CDD:214473 58/242 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.