DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Cela1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:246 Identity:80/246 - (32%)
Similarity:128/246 - (52%) Gaps:22/246 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 TRHRIVGGQETEVHEYPWMIMLMWF--GNFY--CGASLVNDQYALTAAHCVNGFYHRLITVRLL- 138
            |..|:|||.|...:.:|..|.|.:.  |::|  ||.:|:...:.:||||||:.    .:|.|:: 
  Rat    23 TNARVVGGAEARRNSWPSQISLQYLSGGSWYHTCGGTLIRRNWVMTAAHCVSS----QMTFRVVV 83

  Fly   139 -EHN--RQDSHVKIVDRRVSRVLIHPKYSTRNFDS--DIALIRFNEPVRLGIDMHPVCMPTPSEN 198
             :||  :.|...:.|.  |.::::||.:::.|..:  ||||:|..:.|.|...:....:|.....
  Rat    84 GDHNLSQNDGTEQYVS--VQKIVVHPNWNSNNVAAGYDIALLRLAQSVTLNNYVQLAVLPQEGTI 146

  Fly   199 YAGQT-AVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDS 262
            .|... ..:||||.....|.:|.|||:..:|.:....|.:|:|..|.:...|:|||  ..|.:..
  Rat   147 LANNNPCYITGWGRTRTNGQLSQTLQQAYLPSVDYSICSSSSYWGSTVKTTMVCAG--GDGVRSG 209

  Fly   263 CQGDSGGPMHVLGSGDAYQLAGIVSW--GEGCAKPNAPGVYTRVGSFNDWI 311
            ||||||||:|.|.:|. |.:.|:.|:  ..||.....|.|:|||.::..|:
  Rat   210 CQGDSGGPLHCLVNGQ-YSVHGVTSFVSSMGCNVSRKPTVFTRVSAYISWM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 78/241 (32%)
Tryp_SPc 83..314 CDD:238113 78/242 (32%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 78/240 (33%)
Tryp_SPc 27..262 CDD:238113 78/242 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.