DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss11e

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_766468.1 Gene:Tmprss11e / 243084 MGIID:3513175 Length:423 Species:Mus musculus


Alignment Length:337 Identity:113/337 - (33%)
Similarity:160/337 - (47%) Gaps:58/337 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 HLLLILATALGDLACATPSLRSASDPE---KILNNLAQLRQSSFLDWIQSILG-PEVPAEWSSPA 65
            |:|||.            .:||..|||   ||:..:..       :.::...| |.|..|.....
Mouse   117 HMLLIF------------RIRSTEDPETVHKIIEYVLH-------EKLKYATGPPNVDPESVKIK 162

  Fly    66 KRECAECS------CG------NINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYA 118
            |....|..      ||      .:.|..|||||...|..|:||...|.|.|:..|||:|:|:.:.
Mouse   163 KINKTESDNYFNHCCGTRRNKSTVQTSVRIVGGTPVEEEEWPWQSSLRWDGSHRCGATLINNTWL 227

  Fly   119 LTAAHCV---------NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIAL 174
            :|||||.         :..:...:..|.|...            :.|:::|.||...:.|.||||
Mouse   228 VTAAHCFRTHKDPSRWSATFGATLQPRKLTTG------------IRRIIVHEKYKYPSHDYDIAL 280

  Fly   175 IRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNS 238
            ...::||.....:|.||:|..:..: .||...|||:|||...|...:.|::|:|..:..:.|...
Mouse   281 AELSKPVPCTNAVHKVCLPDANHEFQPGQRMFVTGFGALKNDGFTQNNLRQVQVDYIDTQTCNQP 345

  Fly   239 NYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTR 303
            ......||..|:|||:: :|.||:||||||||:......|.:.|||:||||:.|.:||.||||||
Mouse   346 QSYNGAITPRMLCAGFL-KGEKDACQGDSGGPLVTADVRDIWYLAGVVSWGDECGQPNKPGVYTR 409

  Fly   304 VGSFNDWIAENT 315
            |.:|..|||.||
Mouse   410 VTAFRHWIASNT 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/238 (37%)
Tryp_SPc 83..314 CDD:238113 90/240 (38%)
Tmprss11eNP_766468.1 SEA 50..145 CDD:279699 11/46 (24%)
Tryp_SPc 191..417 CDD:214473 88/238 (37%)
Tryp_SPc 192..420 CDD:238113 90/240 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.