DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss11f

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_848845.1 Gene:Tmprss11f / 243083 MGIID:2442348 Length:439 Species:Mus musculus


Alignment Length:318 Identity:104/318 - (32%)
Similarity:159/318 - (50%) Gaps:39/318 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPA----------KRECAECSCG- 75
            ||..||   |:|...:.:       .:.||:...::|...|.|:          .|......|| 
Mouse   135 PSTDSA---ERIKKRIER-------TFYQSLKIKQLPLTISMPSFSLTPIDSKKMRNLLNSRCGI 189

  Fly    76 -----NI-----NTRHRIVGGQETEVH-EYPWMIMLMWFG-NFYCGASLVNDQYALTAAHCVNGF 128
                 ||     ::..|||.|:||.:. |:||...|...| ...|||:|:::.:.||||||   |
Mouse   190 RMSSSNIPLPASSSTERIVQGRETAMEGEWPWQASLQLIGAGHQCGATLISNTWLLTAAHC---F 251

  Fly   129 YHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP 193
            :......:.:..........:|.|.|.:::||.:|.....::||||.:....|.....:..||:|
Mouse   252 WKNRDPTKWIVTFGTTITPPLVKRSVGKIIIHEEYHRDTNENDIALAQLTTRVEFSNVVQRVCLP 316

  Fly   194 TPSENYAGQTAV-VTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQ 257
            ..|.....:|:| |||:|::.:.||..:.|::..|..:..:.|...:..:..||..|:|||::| 
Mouse   317 DSSMKLPPKTSVFVTGFGSIVDDGPTQNKLRQARVETIGSDVCNRKDVYDGLITPGMLCAGFME- 380

  Fly   258 GGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            |..|:|:||||||: |..:.|.:.:.||||||:.||.||.|||||||..:.||||..|
Mouse   381 GKIDACKGDSGGPL-VYDNRDIWYIVGIVSWGQSCALPNKPGVYTRVTKYRDWIASKT 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/231 (36%)
Tryp_SPc 83..314 CDD:238113 86/233 (37%)
Tmprss11fNP_848845.1 SEA 60..164 CDD:396113 9/38 (24%)
Tryp_SPc 207..436 CDD:238113 86/233 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.