DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klk7

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_036002.1 Gene:Klk7 / 23993 MGIID:1346336 Length:249 Species:Mus musculus


Alignment Length:237 Identity:77/237 - (32%)
Similarity:118/237 - (49%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            ||:.|.:.:...:||.:.|:.....:||..||:..:.||||||..|.|.    |:|......|..
Mouse    25 RIIDGYKCKEGSHPWQVALLKGNQLHCGGVLVDKYWVLTAAHCKMGQYQ----VQLGSDKIGDQS 85

  Fly   147 VKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWG- 210
            .:.:  :.::...||.|||:...:||.|:|.:|||::...:..|.:|...|. .|.:..|:||| 
Mouse    86 AQKI--KATKSFRHPGYSTKTHVNDIMLVRLDEPVKMSSKVEAVQLPEHCEP-PGTSCTVSGWGT 147

  Fly   211 ALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLG 275
            ..|........|...:|.::|..||:  ...:..:...|:||| :.....::|.||||||   |.
Mouse   148 TTSPDVTFPSDLMCSDVKLISSRECK--KVYKDLLGKTMLCAG-IPDSKTNTCNGDSGGP---LV 206

  Fly   276 SGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDWIAENTR 316
            ..|..|  |:||||. .|.:||.|||||:|..:..|:.|..:
Mouse   207 CNDTLQ--GLVSWGTYPCGQPNDPGVYTQVCKYKRWVMETMK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 75/230 (33%)
Tryp_SPc 83..314 CDD:238113 75/232 (32%)
Klk7NP_036002.1 Tryp_SPc 25..241 CDD:214473 75/230 (33%)
Serine protease. /evidence=ECO:0000250 26..246 76/234 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.