DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Prss50

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_666339.2 Gene:Prss50 / 235631 MGIID:2447303 Length:439 Species:Mus musculus


Alignment Length:291 Identity:74/291 - (25%)
Similarity:120/291 - (41%) Gaps:67/291 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLL 138
            ||:.:.....:...|.....:|||:.:...|:..|...|:..|:.||.|||::            
Mouse   158 CGSSHEPDPTLRDPEAMTRRWPWMVSVQANGSHICAGILIASQWVLTVAHCLS------------ 210

  Fly   139 EHNRQDSHVKIV----------------DRRVSRVLIHPKYSTRNFDS------DIALIRFNEPV 181
                 .:||..:                |..|.||:|:..|..|.:.|      ||.|::....:
Mouse   211 -----QNHVNYIVRAGSPWINQTAGTSSDVPVHRVIINHGYQPRRYWSWVGRAHDIGLLKLKWGL 270

  Fly   182 RLGIDMHPVCMPTPSENYA---GQTAVVTGWGALSEGG--PISDTLQEVEVPILSQEECRNSNYG 241
            :....:.|:|:  |..:|.   .....|||||.....|  |...:|||.||.||:.::|.:..:.
Mouse   271 KYSKYVWPICL--PGLDYVVEDSSLCTVTGWGYPRANGIWPQFQSLQEKEVSILNSKKCDHFYHK 333

  Fly   242 ESKITD-------NMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPG 299
            .|:|:.       .||||.  :...::.|...:|.|: |..|...:.|.|::|||.||.|..||.
Mouse   334 FSRISSLVRIINPQMICAS--DNNREEFCYEITGEPL-VCSSDGTWYLVGMMSWGPGCKKSEAPP 395

  Fly   300 VYTRVGSFNDWIAENTRDACSCAQPEAAGEP 330
            ::.:|..:..||.:           ..:|||
Mouse   396 IFLQVSYYRPWIWD-----------RLSGEP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 67/262 (26%)
Tryp_SPc 83..314 CDD:238113 69/264 (26%)
Prss50NP_666339.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..130
Tryp_SPc 177..407 CDD:214473 66/251 (26%)
Tryp_SPc 177..407 CDD:238113 66/251 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.