DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TPSD1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:205 Identity:76/205 - (37%)
Similarity:110/205 - (53%) Gaps:23/205 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWFGNF---YCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQD 144
            ||||||....::||.:.|...|.:   :||.||::.|:.|||||||......|..:|:   ..::
Human    38 IVGGQEAPRSKWPWQVSLRVRGPYWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRV---QLRE 99

  Fly   145 SHVKIVDR--RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVV 206
            .|:...|:  .|||:::||::......:||||:...|||.:...:|.|.:|..||.: .|....|
Human   100 QHLYYQDQLLPVSRIIVHPQFYIIQTGADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCWV 164

  Fly   207 TGWGALSEGG--PISDTLQEVEVPILSQEECRNSNY------GES--KITDNMICAGYVEQGGKD 261
            ||||.:....  |....|:|||||::....| |:.|      |.|  .:.|:|:|||   ....|
Human   165 TGWGDVDNNVHLPPPYPLKEVEVPVVENHLC-NAEYHTGLHTGHSFQIVRDDMLCAG---SENHD 225

  Fly   262 SCQGDSGGPM 271
            |||||||||:
Human   226 SCQGDSGGPL 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 76/205 (37%)
Tryp_SPc 83..314 CDD:238113 76/205 (37%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 76/205 (37%)
Tryp_SPc 38..240 CDD:214473 76/205 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152921
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.