Sequence 1: | NP_652645.1 | Gene: | CG18735 / 59137 | FlyBaseID: | FBgn0042098 | Length: | 364 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_036349.1 | Gene: | TPSD1 / 23430 | HGNCID: | 14118 | Length: | 242 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 76/205 - (37%) |
---|---|---|---|
Similarity: | 110/205 - (53%) | Gaps: | 23/205 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 83 IVGGQETEVHEYPWMIMLMWFGNF---YCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQD 144
Fly 145 SHVKIVDR--RVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVV 206
Fly 207 TGWGALSEGG--PISDTLQEVEVPILSQEECRNSNY------GES--KITDNMICAGYVEQGGKD 261
Fly 262 SCQGDSGGPM 271 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18735 | NP_652645.1 | Tryp_SPc | 82..311 | CDD:214473 | 76/205 (37%) |
Tryp_SPc | 83..314 | CDD:238113 | 76/205 (37%) | ||
TPSD1 | NP_036349.1 | Tryp_SPc | 38..242 | CDD:238113 | 76/205 (37%) |
Tryp_SPc | 38..240 | CDD:214473 | 76/205 (37%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165152921 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X11 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |