DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and PRSS54

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001073961.1 Gene:PRSS54 / 221191 HGNCID:26336 Length:395 Species:Homo sapiens


Alignment Length:269 Identity:60/269 - (22%)
Similarity:113/269 - (42%) Gaps:59/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 EYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV-NGFYHRLITVRLLEHNRQD------------ 144
            |:||::            ||.:.||...|..|: :.|:  ::::.....||:|            
Human    52 EFPWVV------------SLQDSQYTHLAFGCILSEFW--VLSIASAIQNRKDIVVIVGISNMDP 102

  Fly   145 SHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVC-----MPTPSENYAGQTA 204
            |.:...:..|:.::||..:...:..::|||::.:..:..|..:..:|     :.||.   ..|..
Human   103 SKIAHTEYPVNTIIIHEDFDNNSMSNNIALLKTDTAMHFGNLVQSICFLGRMLHTPP---VLQNC 164

  Fly   205 VVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGG 269
            .|:||      .|.|.|...:.:.:|.:...::.:...........|..:.::..|.:|.||.|.
Human   165 WVSGW------NPTSATGNHMTMSVLRKIFVKDLDMCPLYKLQKTECGSHTKEETKTACLGDPGS 223

  Fly   270 PMHV-LGSGDAYQLAGIVSW-GEGCAKPNAPG--VYTRVGSFNDWIAENTRDACSCAQPEAAGEP 330
            ||.. |...|.:.|.|:::: ||.|     ||  :||:|..::.||.         ::.|.||.|
Human   224 PMMCQLQQFDLWVLRGVLNFGGETC-----PGLFLYTKVEDYSKWIT---------SKAERAGPP 274

  Fly   331 ASPMETTEQ 339
            .|.:...|:
Human   275 LSSLHHWEK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 52/239 (22%)
Tryp_SPc 83..314 CDD:238113 54/242 (22%)
PRSS54NP_001073961.1 Tryp_SPc 52..264 CDD:214473 52/239 (22%)
Tryp_SPc 52..264 CDD:238113 52/239 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..348
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.