DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and F10

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_000495.1 Gene:F10 / 2159 HGNCID:3528 Length:488 Species:Homo sapiens


Alignment Length:239 Identity:89/239 - (37%)
Similarity:134/239 - (56%) Gaps:11/239 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NTRHRIVGGQETEVHEYPWMIMLMWFGN-FYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN 141
            |...|||||||.:..|.||..:|:...| .:||.:::::.|.||||||:  :..:...||:.:.|
Human   230 NNLTRIVGGQECKDGECPWQALLINEENEGFCGGTILSEFYILTAAHCL--YQAKRFKVRVGDRN 292

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP----TPSENYAGQ 202
            .:..........|..|:.|.:::...:|.|||::|...|:...:::.|.|:|    ..|.....:
Human   293 TEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPACLPERDWAESTLMTQK 357

  Fly   203 TAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDS 267
            |.:|:|:|...|.|..|..|:.:|||.:.:..|:.|:  ...||.||.|||| :...:|:|||||
Human   358 TGIVSGFGRTHEKGRQSTRLKMLEVPYVDRNSCKLSS--SFIITQNMFCAGY-DTKQEDACQGDS 419

  Fly   268 GGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            ||| ||....|.|.:.||||||||||:....|:||:|.:|..||
Human   420 GGP-HVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLKWI 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 86/233 (37%)
Tryp_SPc 83..314 CDD:238113 87/234 (37%)
F10NP_000495.1 GLA 25..85 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:317114
O-glycosylated at one site 183..203
Tryp_SPc 235..464 CDD:238113 87/234 (37%)
O-glycosylated at one site 476..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.