DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and F9

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:298 Identity:95/298 - (31%)
Similarity:150/298 - (50%) Gaps:48/298 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETE 90
            ::::.|.||:|:.|..||                                 .|...|:|||::.:
Human   203 NSTEAETILDNITQSTQS---------------------------------FNDFTRVVGGEDAK 234

  Fly    91 VHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRVS 155
            ..::||.::|....:.:||.|:||:::.:||||||.....  |||...|||.:::......|.|.
Human   235 PGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVK--ITVVAGEHNIEETEHTEQKRNVI 297

  Fly   156 RVLIHPKYST--RNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAG-----QTAVVTGWGALS 213
            |::.|..|:.  ..::.||||:..:||:.|...:.|:|:  ..:.|..     .:..|:|||.:.
Human   298 RIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICI--ADKEYTNIFLKFGSGYVSGWGRVF 360

  Fly   214 EGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGD 278
            ..|..:..||.:.||::.:..|..|.  :..|.:||.|||: .:||:|||||||||| ||.....
Human   361 HKGRSALVLQYLRVPLVDRATCLRST--KFTIYNNMFCAGF-HEGGRDSCQGDSGGP-HVTEVEG 421

  Fly   279 AYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            ...|.||:||||.||.....|:||:|..:.:||.|.|:
Human   422 TSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTK 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/235 (35%)
Tryp_SPc 83..314 CDD:238113 84/237 (35%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:317114
Tryp_SPc 227..457 CDD:238113 84/237 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.