DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss13

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_006510195.1 Gene:Tmprss13 / 214531 MGIID:2682935 Length:561 Species:Mus musculus


Alignment Length:257 Identity:93/257 - (36%)
Similarity:144/257 - (56%) Gaps:16/257 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 PAKRECA-ECS-CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN 126
            |::|..: :|| ||......|||||..|...::||.:.|.:.....||.:|::.|:.||||||  
Mouse   299 PSRRYVSLQCSHCGLRAMTGRIVGGALTSESKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHC-- 361

  Fly   127 GFYHRLITVRLLE-----HNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGID 186
             |:  :...:|||     ....:.|.......:|:::|:..|:....|.||||||.::|:.|...
Mouse   362 -FF--VTREKLLEGWKVYAGTSNLHQLPEAASISQIIINGNYTDEQDDYDIALIRLSKPLTLSAH 423

  Fly   187 MHPVCMPTPSENYA-GQTAVVTGWGALSE-GGPISDTLQEVEVPILSQEECRNSNYGESKITDNM 249
            :||.|:|...:.:. .:|..:||:|...| ....|..|:||:|.::..::|.:....:|.:|..|
Mouse   424 IHPACLPMHGQTFGLNETCWITGFGKTKETDEKTSPFLREVQVNLIDFKKCNDYLVYDSYLTPRM 488

  Fly   250 ICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            :|||.: :||:||||||||||: |....:.:.|||:.|||.||.:.|.|||||:|.....||
Mouse   489 MCAGDL-RGGRDSCQGDSGGPL-VCEQNNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWI 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/235 (36%)
Tryp_SPc 83..314 CDD:238113 86/236 (36%)
Tmprss13XP_006510195.1 PHA03378 <6..>122 CDD:223065
LDLa <204..220 CDD:238060
SRCR_2 225..314 CDD:373897 6/14 (43%)
Tryp_SPc 319..548 CDD:214473 85/235 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.