DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and ELANE

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001963.1 Gene:ELANE / 1991 HGNCID:3309 Length:267 Species:Homo sapiens


Alignment Length:279 Identity:74/279 - (26%)
Similarity:113/279 - (40%) Gaps:38/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSC-------GNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN 126
            |...:|       |.......||||:....|.:|:|:.|...|..:|||:|:...:.::|||||.
Human     9 CLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLIAPNFVMSAAHCVA 73

  Fly   127 GFYHRLITVRLLEHN---RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMH 188
            ....|.:.|.|..||   |:.:......:|:    ....|...|..:||.:::.|....:..::.
Human    74 NVNVRAVRVVLGAHNLSRREPTRQVFAVQRI----FENGYDPVNLLNDIVILQLNGSATINANVQ 134

  Fly   189 PVCMPTPSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICA 252
            ...:|....... |...:..|||.|.....|:..|||:.|.::: ..||.||          :|.
Human   135 VAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVT-SLCRRSN----------VCT 188

  Fly   253 GYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDW---IAE 313
             .|.......|.||||.|:...|     .:.||.|:.. |||....|..:..|..|.:|   |.:
Human   189 -LVRGRQAGVCFGDSGSPLVCNG-----LIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQ 247

  Fly   314 NTRDACSCAQPEAAGEPAS 332
            .:.|. .|..|... :|||
Human   248 RSEDN-PCPHPRDP-DPAS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 64/236 (27%)
Tryp_SPc 83..314 CDD:238113 65/238 (27%)
ELANENP_001963.1 Tryp_SPc 30..245 CDD:238113 64/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.