DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss11a

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_006534903.1 Gene:Tmprss11a / 194597 MGIID:2684853 Length:392 Species:Mus musculus


Alignment Length:267 Identity:88/267 - (32%)
Similarity:141/267 - (52%) Gaps:21/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTA 121
            :||:.|....::|.:.:...|  .:|||.|.......:||.:.|.......||.:|:.:.:.:||
Mouse   137 LPADVSLVQVKDCGKRAIPLI--ANRIVSGNPAAKGAWPWQVSLQRSNIHQCGGTLIGNMWVVTA 199

  Fly   122 AHCVNGFYHRLITVRLLEHNRQ-------DSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNE 179
            |||          .|...:.||       ..:..::.|.|.|:::|.:|.....|.||||::|:.
Mouse   200 AHC----------FRTNSNPRQWTLSFGTTINPPLMKRDVRRIIMHERYRPPARDHDIALVQFSP 254

  Fly   180 PVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGES 243
            .|....::..:|:|.||.:: ...|..:||:|||..||...:.|:|..|.|:|.:.|:..:...:
Mouse   255 RVTFSDEVRRICLPEPSASFPPNSTVYITGFGALYYGGESQNELREARVQIISNDICKKRHVYGN 319

  Fly   244 KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFN 308
            :|...|.|||::| |..|:|:||||||:.:..:.|.:.|.||||||:.|.:.|.|||||:|..:.
Mouse   320 EIKRGMFCAGFLE-GNYDACRGDSGGPLVIRDNKDTWYLIGIVSWGDNCGQKNKPGVYTQVTYYR 383

  Fly   309 DWIAENT 315
            .|||..|
Mouse   384 HWIASKT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 79/236 (33%)
Tryp_SPc 83..314 CDD:238113 81/238 (34%)
Tmprss11aXP_006534903.1 SEA 42..135 CDD:366610
Tryp_SPc 161..389 CDD:238113 81/238 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 179 1.000 Inparanoid score I3995
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8807
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.