DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and try-7

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_491910.2 Gene:try-7 / 191201 WormBaseID:WBGene00006625 Length:380 Species:Caenorhabditis elegans


Alignment Length:340 Identity:65/340 - (19%)
Similarity:121/340 - (35%) Gaps:98/340 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFY---------CGASLVNDQYALTAAHCVNGF 128
            |||. ..:.::..|::....|.||.:    |...|         |..::|:.::.|.|.||..| 
 Worm    32 SCGK-PLQSKVYNGRDASQSEAPWSV----FTYLYSKDEQSATTCTGTIVSPRHILIATHCFAG- 90

  Fly   129 YHRLITVRLLEHNRQDSHVKIVD------------------RRVSR-----VLIH---------- 160
            .:|..:..|:|.....|:.|..|                  :.:||     .|:|          
 Worm    91 QNRDGSWNLIEDTFDRSNCKDDDYVITNQEFLKRVEFLSNKKGISRYPEKITLVHACTKRTANRT 155

  Fly   161 ----PKYSTRNFDSDIALIRFNEPVRLGIDMHPVCM----PTPSENYAGQTAVVTGWGA-----L 212
                |:|.|    .|.|::...|.:....::..||:    ..|::..:.:   ..|:|.     :
 Worm   156 KKIPPQYYT----DDFAIVHLYEELTFSSNVQSVCVADDETQPNDKLSLE---YFGFGLNPPSDI 213

  Fly   213 SEGGPISDT--LQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLG 275
            ::.| :.:|  |:..::.:..........:....|||..:           :|.|||||......
 Worm   214 NQNG-VDNTGQLRYEKIEVFRSHPMEIYFFQARDITDKTV-----------ACVGDSGGGAIADV 266

  Fly   276 SGDAYQLAGIVSWGEGCAKPNAPG----VYTRVGSFNDWIAENTRDACSCAQPEAAGE------- 329
            .|.. .:.|::| ...|.|.....    :|:.||.:.:.|.:.|.   .|.:.::..:       
 Worm   267 KGKK-TIIGVLS-QTSCQKRRGGNETMELYSSVGFYKNQICKYTG---ICDKADSYNKYHKGYIR 326

  Fly   330 PASPMETTEQGDQEN 344
            ...|:.|||...:.|
 Worm   327 TQKPVRTTEAPREAN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 54/289 (19%)
Tryp_SPc 83..314 CDD:238113 55/291 (19%)
try-7NP_491910.2 DUF316 5..311 CDD:367641 59/308 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.