DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Plau

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_032899.1 Gene:Plau / 18792 MGIID:97611 Length:433 Species:Mus musculus


Alignment Length:276 Identity:90/276 - (32%)
Similarity:135/276 - (48%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFG------NFYCGASLVNDQYALT 120
            ||...::..:|....:..|.:||||:.|||...||...:....      :|.||.||::..:..:
Mouse   159 SSSVDQQGFQCGQKALRPRFKIVGGEFTEVENQPWFAAIYQKNKGGSPPSFKCGGSLISPCWVAS 223

  Fly   121 AAHCVNGFYHRLITVRLLEHNRQDSH----VKIVDRRVSRVLIHPKY--STRNFDSDIALIRFN- 178
            ||||......:...|..|..:::.|:    :|.   .|.::::|..|  .:..:.:||||::.. 
Mouse   224 AAHCFIQLPKKENYVVYLGQSKESSYNPGEMKF---EVEQLILHEYYREDSLAYHNDIALLKIRT 285

  Fly   179 ------EPVRLGIDMHPVCMPTPSENYA--GQTAVVTGWGALSEGGPISD-----TLQEVEVPIL 230
                  :|.|   .:..:|:| |....|  |....:||:|..||    ||     .|:...|.::
Mouse   286 STGQCAQPSR---SIQTICLP-PRFTDAPFGSDCEITGFGKESE----SDYLYPKNLKMSVVKLV 342

  Fly   231 SQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKP 295
            |.|:|...:|..|:|...|:||...| ...|||:||||||: :........|:||||||.|||:.
Mouse   343 SHEQCMQPHYYGSEINYKMLCAADPE-WKTDSCKGDSGGPL-ICNIEGRPTLSGIVSWGRGCAEK 405

  Fly   296 NAPGVYTRVGSFNDWI 311
            |.|||||||..|.|||
Mouse   406 NKPGVYTRVSHFLDWI 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/254 (33%)
Tryp_SPc 83..314 CDD:238113 86/255 (34%)
PlauNP_032899.1 Binds urokinase plasminogen activator surface receptor. /evidence=ECO:0000250 35..58
Kringle 71..152 CDD:333799
Connecting peptide 153..179 4/19 (21%)
Tryp_SPc 180..424 CDD:238113 86/255 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.