DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and try-3

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:254 Identity:86/254 - (33%)
Similarity:122/254 - (48%) Gaps:36/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 RIVGGQETEVHEYPWMIMLMWFGN----FYCGASLVNDQYALTAAHCVNGFYHR-LITVRLLEHN 141
            ||:||...: ....||..|:.:|:    ..|||::::|.:.:|||||......| .:.||..::|
 Worm    37 RIIGGNSID-DGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHCALQLQTRSFVYVREPKNN 100

  Fly   142 RQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPV-RLGIDMHPVCMPTPSENYAGQ--T 203
            |:.|.      .|....||..|:.:..|:||||:|.:..: :|||  .|||:.........|  .
 Worm   101 RERSF------SVKEAYIHSGYNNQTADNDIALLRISSDLSKLGI--KPVCLVHDDSKLLKQYKN 157

  Fly   204 AVVTGWGAL----SEGGP---ISDTLQEVEVPILSQEEC----RNSNYGESKITDNMICAGYVEQ 257
            .||.|:|..    |.|.|   .|.|||...|||:|.::|    |..:....|||...||||....
 Worm   158 GVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITGYQICAGAYLH 222

  Fly   258 GGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG----EGCA-KPNAPGVYTRVGSFNDWI 311
            |   :..||||||:.:..|...|...||.|:|    :|.. :...||||||:..:..||
 Worm   223 G---TAPGDSGGPLLIHKSNGEYVQIGITSYGADGLDGVIDQGKFPGVYTRISKYVPWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/252 (33%)
Tryp_SPc 83..314 CDD:238113 85/253 (34%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 85/253 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.