DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and svh-1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:266 Identity:91/266 - (34%)
Similarity:142/266 - (53%) Gaps:42/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CG----NINTRH-------RIVGGQETEVHEYPWMIMLMWFGN-----FYCGASLVNDQYALTAA 122
            ||    .:|.|.       |:|||.||....:||...|.   |     .:||||:::..:.:|||
 Worm   693 CGLRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAALR---NKATKAHHCGASILDKTHLITAA 754

  Fly   123 HC------VNGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPV 181
            ||      |:.:.   :.|...::|:.|.:.:|.  .:.|:..:|.|.. .|..|||::....| 
 Worm   755 HCFEEDERVSSYE---VVVGDWDNNQTDGNEQIF--YLQRIHFYPLYKD-IFSHDIAILEIPYP- 812

  Fly   182 RLGIDMH----PVCMPTPSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYG 241
              ||:.:    |:|:|:....|. |:..||:|||::  |...::.||...:||:::.:|.||:..
 Worm   813 --GIEFNEYAQPICLPSKDFVYTPGRQCVVSGWGSM--GLRYAERLQAALIPIINRFDCVNSSQI 873

  Fly   242 ESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGS 306
            .|.::.:..||||:| ||.||||||||||........|:.|||::|||:|||:...||:||.|..
 Worm   874 YSSMSRSAFCAGYLE-GGIDSCQGDSGGPFACRREDGAFVLAGVISWGDGCAQKKQPGIYTMVAP 937

  Fly   307 FNDWIA 312
            :..||:
 Worm   938 YLSWIS 943

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/244 (35%)
Tryp_SPc 83..314 CDD:238113 86/246 (35%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996
Tryp_SPc 713..945 CDD:238113 86/246 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14756
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.