DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and try-8

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_504916.1 Gene:try-8 / 179134 WormBaseID:WBGene00017791 Length:401 Species:Caenorhabditis elegans


Alignment Length:340 Identity:73/340 - (21%)
Similarity:114/340 - (33%) Gaps:105/340 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCG------NINTRHRIVGGQETEVHEYPWMIMLM----WFGNFYCGASLVNDQYALTAAHCVNG 127
            :||      :..|| :::.|......|.||.:.|.    ...:.|...:||::::.::       
 Worm    35 TCGTKMREADSYTR-KVLNGTIANAGETPWTVALYIPDHLDHSVYTTGTLVSNRHIIS------- 91

  Fly   128 FYHRLITVRL-----LEHN------------------------------------RQDSHVKIVD 151
             |.||.....     |.||                                    ||..|.:: |
 Worm    92 -YDRLFLTNTTDGIKLRHNLKAVIEKDMECEGNDYLLPSDLVRSVAVFLDLLSVERQSGHEQL-D 154

  Fly   152 RRVSRVLIHPKYSTRNFD-SDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEG 215
            .:..|:|   ....::|. :.:|:|...:||..|.:..|:|..:....|.|..  ..|:|  ...
 Worm   155 VKSVRIL---NGCVKSFQFNRVAVIELKKPVHKGQNARPICFGSDFRIYTGYK--FFGYG--DNR 212

  Fly   216 GPISD-TLQEV---EVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGG----PMH 272
            |.:.| ||:..   |||      |::.       ::::.|.    ......|.||.||    ..|
 Worm   213 GAVKDATLRHTKIKEVP------CKHP-------SEDLFCV----TAENPLCNGDFGGAAVSKFH 260

  Fly   273 VLGSGDAYQLAGI-VSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQPEAAGEPASPMET 336
              ||..||   |: |.....|.|.|...|||......  :||:..|......|....:..:...|
 Worm   261 --GSVRAY---GVYVDGPYECNKANRRTVYTFANMTK--LAESLCDVTGICAPYLPSQQTTVTTT 318

  Fly   337 ---TEQGDQENTTAN 348
               ....|..|||.|
 Worm   319 ITPVTSIDHTNTTPN 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 59/283 (21%)
Tryp_SPc 83..314 CDD:238113 60/285 (21%)
try-8NP_504916.1 DUF316 11..304 CDD:367641 66/309 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.