DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and try-1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_494910.2 Gene:try-1 / 173856 WormBaseID:WBGene00006619 Length:293 Species:Caenorhabditis elegans


Alignment Length:263 Identity:99/263 - (37%)
Similarity:140/263 - (53%) Gaps:34/263 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 AKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLM-WFGNFYCGASLVNDQYALTAAHCVNGF 128
            |:...|:.....:...||::||.|:..|.:||.:.|: ..|:..||.||::..:.||||||    
 Worm    40 AQTRSAQEPADYVTLDHRLIGGSESSPHSWPWTVQLLSRLGHHRCGGSLIDPNFVLTAAHC---- 100

  Fly   129 YHRLITVRLLEHNRQDSH-VKI--------VDRRVSRVLIHPKYSTRNFDS--DIALIRFNEPVR 182
                    ..:..|..|: |::        ...||:.|.|||.|:. .|.|  |.|::|.:.||.
 Worm   101 --------FAKDRRPTSYSVRVGGHRSGSGSPHRVTAVSIHPWYNI-GFPSSYDFAIMRIHPPVN 156

  Fly   183 LGIDMHPVCMPT-PS-ENYAGQTAVVTGWGALSEGGPIS-DTLQEVEVPILSQEECRN-SNYGES 243
            ......|:|:|: |: ||   :..||||||:..||..:| .||:|:.||:||...|.: .||...
 Worm   157 TSTTARPICLPSLPAVEN---RLCVVTGWGSTIEGSSLSAPTLREIHVPLLSTLFCSSLPNYIGR 218

  Fly   244 KITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFN 308
            ....:|:|||| ..|..||||||||||:.....|. ::|.|:||||.|||:|..||||..|.|.:
 Worm   219 IHLPSMLCAGY-SYGKIDSCQGDSGGPLMCARDGH-WELTGVVSWGIGCARPGMPGVYGNVHSAS 281

  Fly   309 DWI 311
            .||
 Worm   282 TWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 94/244 (39%)
Tryp_SPc 83..314 CDD:238113 95/245 (39%)
try-1NP_494910.2 Tryp_SPc 59..285 CDD:238113 95/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 147 1.000 Domainoid score I2768
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 153 1.000 Inparanoid score I2933
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14756
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3952
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.