DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tpsb2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:290 Identity:104/290 - (35%)
Similarity:152/290 - (52%) Gaps:41/290 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LRQSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFG 104
            |::...|.|..|:|...|   :|:|..          .|.|..||||.|....::||.:.|.:..
Mouse     2 LKRLLLLLWALSLLASLV---YSAPRP----------ANQRVGIVGGHEASESKWPWQVSLRFKL 53

  Fly   105 NF---YCGASLVNDQYALTAAHCVNGFYH--RLITVRLLEHNRQDSHVKIVDRRVS--RVLIHPK 162
            |:   :||.||::.|:.|||||||.....  :|..|:|     ::.::...|:.:|  |:::||.
Mouse    54 NYWIHFCGGSLIHPQWVLTAAHCVGPHIKSPQLFRVQL-----REQYLYYGDQLLSLNRIVVHPH 113

  Fly   163 YSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWGALSEGGPISD--TLQE 224
            |.|....:|:||:....||.:...:||:.:|..||.: .|.:..|||||.:....|:..  .|::
Mouse   114 YYTAEGGADVALLELEVPVNVSTHLHPISLPPASETFPPGTSCWVTGWGDIDNDEPLPPPYPLKQ 178

  Fly   225 VEVPILSQEECRNSNYGESKIT--------DNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQ 281
            |:|||:....| :..|.....|        |.|:|||...   :||||||||||:.....|...|
Mouse   179 VKVPIVENSLC-DRKYHTGLYTGDDFPIVHDGMLCAGNTR---RDSCQGDSGGPLVCKVKGTWLQ 239

  Fly   282 LAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
             ||:||||||||:||.||:||||..:.|||
Mouse   240 -AGVVSWGEGCAQPNKPGIYTRVTYYLDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 92/246 (37%)
Tryp_SPc 83..314 CDD:238113 94/247 (38%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 94/247 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.