DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Masp1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_036015702.1 Gene:Masp1 / 17174 MGIID:88492 Length:746 Species:Mus musculus


Alignment Length:323 Identity:101/323 - (31%)
Similarity:148/323 - (45%) Gaps:69/323 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 KILNNLAQLRQ-SSFLDWIQSILGPEVPAEWSSPAKRECAEC--SCG----NINTRHRIVGGQET 89
            |:|:|...:.. |:...|...:|            ||....|  .||    :.....||..|:..
Mouse   408 KMLHNTTGVYTCSAHGTWTNEVL------------KRSLPTCLPVCGVPKFSRKQISRIFNGRPA 460

  Fly    90 EVHEYPWMIMLMWF-GNFYCGASLVNDQYALTAAHCVN-------------------------GF 128
            :....||:.||... |..:||.||:...:.||||||::                         |.
Mouse   461 QKGTMPWIAMLSHLNGQPFCGGSLLGSNWVLTAAHCLHQSLDPEEPTLHSSYLLSPSDFKIIMGK 525

  Fly   129 YHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMP 193
            :.|    |..:.:.|..|||       |..:||.|:...|::|:.|:..:|..||...:.|||:|
Mouse   526 HWR----RRSDEDEQHLHVK-------RTTLHPLYNPSTFENDLGLVELSESPRLNDFVMPVCLP 579

  Fly   194 -TPSENYAGQTAVVTGWGA--LSEGGPISDTLQEVEVPILSQEECRNSNYG--ESKITDNMICAG 253
             .||..  |...:|:|||.  |..   ..:.|.|:|:||::.:.|:.: |.  :.|:|.:|||||
Mouse   580 EQPSTE--GTMVIVSGWGKQFLQR---FPENLMEIEIPIVNSDTCQEA-YTPLKKKVTKDMICAG 638

  Fly   254 YVEQGGKDSCQGDSGGPMHVL-GSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
             .::||||:|.|||||||... ...|.:.|.|:|||||.|.|.:..|||:.:....|||...|
Mouse   639 -EKEGGKDACAGDSGGPMVTKDAERDQWYLVGVVSWGEDCGKKDRYGVYSYIYPNKDWIQRIT 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/260 (33%)
Tryp_SPc 83..314 CDD:238113 88/262 (34%)
Masp1XP_036015702.1 CUB 33..142 CDD:238001
FXa_inhibition 158..186 CDD:405372
CUB 190..299 CDD:395345
PHA02639 <305..>438 CDD:165022 8/41 (20%)
CCP 306..368 CDD:153056
Tryp_SPc 454..699 CDD:238113 88/262 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.