DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CFD

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001304264.1 Gene:CFD / 1675 HGNCID:2771 Length:260 Species:Homo sapiens


Alignment Length:272 Identity:86/272 - (31%)
Similarity:127/272 - (46%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ILGPEVPAE----WSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASL 112
            :||.....|    |::|              .|.||:||:|.|.|..|:|..:...|...||..|
Human    12 LLGAAACGEEAWAWAAP--------------PRGRILGGREAEAHARPYMASVQLNGAHLCGGVL 62

  Fly   113 VNDQYALTAAHCVNGFYHRLITVRLLEH--NRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALI 175
            |.:|:.|:||||:.......:.|.|..|  ::.:...::.|  |.|.:.||.......|.|:.|:
Human    63 VAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEPSKRLYD--VLRAVPHPDSQPDTIDHDLLLL 125

  Fly   176 RFNEPVRLGIDMHPVCMPTPSENY-----AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC 235
            :.:|...||    |...|.|.:..     .|....|.|||.::..|...|:||.|.:|:|.:..|
Human   126 QLSEKATLG----PAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATC 186

  Fly   236 RNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEG-CAKPNAPG 299
            ....:.:..||:.::||   |...:|||:||||||: |.|.    .|.|:|:.|.. |.....||
Human   187 NRRTHHDGAITERLMCA---ESNRRDSCKGDSGGPL-VCGG----VLEGVVTSGSRVCGNRKKPG 243

  Fly   300 VYTRVGSFNDWI 311
            :||||.|:..||
Human   244 IYTRVASYAAWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 78/236 (33%)
Tryp_SPc 83..314 CDD:238113 79/237 (33%)
CFDNP_001304264.1 Tryp_SPc 32..255 CDD:214473 78/236 (33%)
Tryp_SPc 33..258 CDD:238113 79/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.