DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klk1b8

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_032483.1 Gene:Klk1b8 / 16624 MGIID:892018 Length:261 Species:Mus musculus


Alignment Length:263 Identity:84/263 - (31%)
Similarity:128/263 - (48%) Gaps:40/263 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 SCGNINT----RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHC-VNGFYHRL 132
            |.|.|:.    :.|:|||...|.:..||.:.:.......||..|:...:.|||||| |:.:...|
Mouse    11 SLGGIDAAPPLQSRVVGGFNCEKNSQPWQVAVYDNKEHICGGVLLERNWVLTAAHCYVDQYEVWL 75

  Fly   133 ITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYST-----------RNFDSDIALIRFNEPVRLGID 186
            ...:|.:......|     |.||:...||.::.           .:|.:|:.|:|.::|..:...
Mouse    76 GKNKLFQEEPSAQH-----RLVSKSFPHPGFNMSLLTLKEIPPGADFSNDLMLLRLSKPADITDA 135

  Fly   187 MHPVCMPTPSENYAGQTAVVTGWGALSEGGPIS----DTLQEVEVPILSQEEC-RNSNYGESKIT 246
            :.|:.:|| .|:..|.|.:.:|||:::   |..    |.||.|.:.:|..:.| .|.|.   |:|
Mouse   136 VKPITLPT-KESKLGSTCLASGWGSIT---PTKWQKPDDLQCVFLKLLPIKNCIENHNV---KVT 193

  Fly   247 DNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGE-GCAKPNAPGVYTRVGSFNDW 310
            |.|:|||.: .|||:.|:||||||: :..|    .|.||.|.|. .|.||..|.:||.:..||.|
Mouse   194 DVMLCAGEM-SGGKNICKGDSGGPL-ICDS----VLQGITSTGPIPCGKPGVPAMYTNLIKFNSW 252

  Fly   311 IAE 313
            |.:
Mouse   253 IKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 79/246 (32%)
Tryp_SPc 83..314 CDD:238113 80/249 (32%)
Klk1b8NP_032483.1 Tryp_SPc 24..253 CDD:214473 79/246 (32%)
Tryp_SPc 25..256 CDD:238113 80/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.