DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klkb1

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_032481.2 Gene:Klkb1 / 16621 MGIID:102849 Length:638 Species:Mus musculus


Alignment Length:336 Identity:109/336 - (32%)
Similarity:163/336 - (48%) Gaps:54/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CNFHLLLILATALGDLACATPSLRSASD--PEKILNNLA-----QLRQSSFLDWIQSILGPEVPA 59
            |.|.:..:|.....:..|.. |||.::|  |.:|...:.     .||....:|            
Mouse   328 CQFFIYSLLPQDCKEEGCKC-SLRLSTDGSPTRITYGMQGSSGYSLRLCKLVD------------ 379

  Fly    60 EWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIML---MWFGNFYCGASLVNDQYALTA 121
               ||      :|:. .||.  |||||....:.|:||.:.|   :......||.|::..|:.|||
Mouse   380 ---SP------DCTT-KINA--RIVGGTNASLGEWPWQVSLQVKLVSQTHLCGGSIIGRQWVLTA 432

  Fly   122 AHCVNG--------FYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFN 178
            |||.:|        .|..::::..:......|       |:..::||.:|.....:.|||||:..
Mouse   433 AHCFDGIPYPDVWRIYGGILSLSEITKETPSS-------RIKELIIHQEYKVSEGNYDIALIKLQ 490

  Fly   179 EPVRLGIDMHPVCMPTPSE-NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGE 242
            .|:.......|:|:|:.:: |.......|||||...|.|...:.||:..:|::..|||: ..|.:
Mouse   491 TPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKEQGETQNILQKATIPLVPNEECQ-KKYRD 554

  Fly   243 SKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSF 307
            ..|...|||||| ::||.|:|:||||||:....|| .:||.||.|||||||:.:.|||||:|..:
Mouse   555 YVINKQMICAGY-KEGGTDACKGDSGGPLVCKHSG-RWQLVGITSWGEGCARKDQPGVYTKVSEY 617

  Fly   308 NDWIAENTRDA 318
            .|||.|.|:.:
Mouse   618 MDWILEKTQSS 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 87/240 (36%)
Tryp_SPc 83..314 CDD:238113 88/242 (36%)
Klkb1NP_032481.2 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 201..284 CDD:128519
APPLE 292..375 CDD:128519 12/47 (26%)
Tryp_SPc 390..621 CDD:214473 87/240 (36%)
Tryp_SPc 391..621 CDD:238113 86/239 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.