DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Klk1b21

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_011249110.1 Gene:Klk1b21 / 16616 MGIID:892022 Length:296 Species:Mus musculus


Alignment Length:357 Identity:97/357 - (27%)
Similarity:140/357 - (39%) Gaps:119/357 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLLILATALGDLACATPSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRECA 70
            |:|.||.:||::..|.|                          :||                   
Mouse     4 LILFLALSLGEIDAAPP--------------------------VQS------------------- 23

  Fly    71 ECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHR---- 131
                       |||||...|.:..||.:.:..:..:.||..|:|..:.||||||......:    
Mouse    24 -----------RIVGGFNCEKNSQPWHVAVFRYNKYICGGVLLNPNWVLTAAHCYGNATSQYNVW 77

  Fly   132 LITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTR-----------NFDSDIALIRFNEPVRLGI 185
            |...:|.:|.....|     |.||:...||.|:..           ::.:|:.|:|.::|..:..
Mouse    78 LGKNKLFQHESSAQH-----RLVSKSFPHPDYNMSLMNDHTPHPEDDYSNDLMLLRLSKPADITD 137

  Fly   186 DMHPVCMPTPSENYAGQTAVVTGWG---------------------------------ALSEGGP 217
            .:.|:.:|| .|...|.|.:.:|||                                 :||..|.
Mouse   138 AVKPIDLPT-EEPKLGSTCLASGWGSITPTKCESAPRNIARCRGGAEGPGLGPVHHPLSLSSTGQ 201

  Fly   218 ISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQL 282
            |.:.||...:..|..|.|..:..  .|:||.|:|||.: .||||:|.||||||:...|     .|
Mouse   202 IPNDLQCGFIKPLPNENCAKAYI--HKVTDVMLCAGEM-GGGKDTCAGDSGGPLICDG-----VL 258

  Fly   283 AGIVSWGE-GCAKPNAPGVYTRVGSFNDWIAE 313
            .||.|||. .|||||||.:||::..|..||.:
Mouse   259 QGITSWGSIPCAKPNAPAIYTKLIKFTSWIKD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 85/277 (31%)
Tryp_SPc 83..314 CDD:238113 86/280 (31%)
Klk1b21XP_011249110.1 Tryp_SPc 25..291 CDD:238113 86/280 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.