DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_008766769.1 Gene:Tmprss2 / 156435 RGDID:620766 Length:580 Species:Rattus norvegicus


Alignment Length:258 Identity:89/258 - (34%)
Similarity:131/258 - (50%) Gaps:20/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 CAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN------- 126
            |.||...::..:.|||||......::||.:.|...|...||.|::..::.:||||||.       
  Rat   240 CIECGVRSVRRQSRIVGGSTASPGDWPWQVSLHVQGIHVCGGSIITPEWIVTAAHCVEEPLSSPR 304

  Fly   127 --GFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHP 189
              ..:..::...|:.:..:        .:|.:|:.||.|.::..::||||::...|:.....:.|
  Rat   305 YWTAFAGILKQSLMFYGSR--------HQVEKVISHPNYDSKTKNNDIALMKLQTPLAFNDVVKP 361

  Fly   190 VCMPTPSENY-AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAG 253
            ||:|.|.... ..|...::||||..|.|..||.|....||::...:|.:.....:.||..|||||
  Rat   362 VCLPNPGMMLDLAQECWISGWGATYEKGKTSDVLNAAMVPLIEPSKCNSKYIYNNLITPAMICAG 426

  Fly   254 YVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR 316
            :: ||..||||||||||:..| ..:.:.|.|..|||.||||...||||..|..|.|||.:..|
  Rat   427 FL-QGSVDSCQGDSGGPLVTL-KNEIWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYQQMR 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/238 (35%)
Tryp_SPc 83..314 CDD:238113 84/240 (35%)
Tmprss2XP_008766769.1 LDLa 112..147 CDD:238060
SRCR_2 152..247 CDD:292133 3/6 (50%)
Tryp_SPc 253..482 CDD:214473 83/238 (35%)
Tryp_SPc 254..485 CDD:238113 84/240 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3918
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm45531
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.