DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CG12256

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:271 Identity:82/271 - (30%)
Similarity:128/271 - (47%) Gaps:63/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NINTRHRIVGGQETEVHEY-PWMIMLMWFG-----NFYCGASLVNDQYALTAAHCVNGFYHRLIT 134
            ::|::.|:|||.:....|| |:.:.:.:..     ..:||.||:.....|||||||||       
  Fly    40 DLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNG------- 97

  Fly   135 VRLLEHNRQDSHVKIV-------DRRVSRVLIHPKYSTRNFD----SDIALIRFNEPVRL----- 183
                   :..|.:.:|       |....|..:.......|:.    ||||:::.:.|..|     
  Fly    98 -------QNASRISVVAGIRDLNDSSGFRSQVQSYEMNENYQELVTSDIAILKIDPPFELDEKRV 155

  Fly   184 ------GIDMHPVCMPTPSENYAGQTAVVTGWGALSE--GGPIS---DTLQEVEVPILSQEECRN 237
                  |.||..          |.|..::||||::..  .||.:   ..||:::...||..:|:.
  Fly   156 STIDVSGSDMVG----------ADQEVLLTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKE 210

  Fly   238 SNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYT 302
            :   .:::||..|||  :|:.||.:|.||||||: |:.||::|:..|:||:|......|.|.|||
  Fly   211 T---MTQLTDTEICA--LERFGKGACNGDSGGPL-VMKSGESYKQVGVVSYGTAFCASNNPDVYT 269

  Fly   303 RVGSFNDWIAE 313
            ||..|:.||.|
  Fly   270 RVSMFDGWIKE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 78/261 (30%)
Tryp_SPc 83..314 CDD:238113 80/264 (30%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 78/261 (30%)
Tryp_SPc 47..280 CDD:238113 79/262 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.