DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and Tmprss3

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001157248.1 Gene:Tmprss3 / 140765 MGIID:2155445 Length:475 Species:Mus musculus


Alignment Length:315 Identity:115/315 - (36%)
Similarity:170/315 - (53%) Gaps:27/315 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LACAT---PSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPAEWSSPAKRE-CA------- 70
            :|||.   ||..| ||..:: :.|.:..|..|:.....:...:|.|...|...|| |.       
Mouse   162 IACAQLGFPSYVS-SDHLRV-DALEEQFQGDFVSINHLLSDDKVTALHHSVYMREGCTSGHVVTL 224

  Fly    71 ECS-CGNINTR----HRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYH 130
            :|| ||   ||    .|||||..:.:.::||.:.|.:.|...||.|::...:.:||||||...||
Mouse   225 KCSACG---TRTGYSPRIVGGNMSSLTQWPWQVSLQFQGYHLCGGSIITPLWIVTAAHCVYDLYH 286

  Fly   131 -RLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPT 194
             :..||::...:..||.|.  ...|.:::.|.||..:...:||||::.:||:.....:.|:|:|.
Mouse   287 PKSWTVQVGLVSLMDSPVP--SHLVEKIIYHSKYKPKRLGNDIALMKLSEPLTFDETIQPICLPN 349

  Fly   195 PSENYA-GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQG 258
            ..||:. |:....:||||..:||..|..|....||::|.:.|.:.:.....|:.:|:||||: :|
Mouse   350 SEENFPDGKLCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYL-KG 413

  Fly   259 GKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            |.||||||||||: |......::|.|..|:|.|||:.|.||||||:.||.|||.|
Mouse   414 GVDSCQGDSGGPL-VCQERRLWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 89/230 (39%)
Tryp_SPc 83..314 CDD:238113 91/233 (39%)
Tmprss3NP_001157248.1 LDLa 96..129 CDD:238060
SRCR_2 134..233 CDD:292133 22/75 (29%)
Tryp_SPc 238..465 CDD:214473 89/230 (39%)
Tryp_SPc 239..468 CDD:238113 91/233 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11120
orthoMCL 1 0.900 - - OOG6_100031
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.