DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and TMPRSS11B

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_872308.2 Gene:TMPRSS11B / 132724 HGNCID:25398 Length:416 Species:Homo sapiens


Alignment Length:317 Identity:108/317 - (34%)
Similarity:153/317 - (48%) Gaps:45/317 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PSLRSASDPEKILNNLAQLRQSSFLDWIQSILGPEVPA-----EWSSPAKRECAECSCG-----N 76
            |.....|...||...|.|:.:::...|      ..|||     |.|..|........||     :
Human   120 PPAEGVSMRTKIKAKLHQMLKNNMASW------NAVPASIKLMEISKAASEMLTNNCCGRQVANS 178

  Fly    77 INTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHN 141
            |.|.::||.|:.:....:||...:.|.|..||||||::.::.|:||||.           ..::|
Human   179 IITGNKIVNGKSSLEGAWPWQASMQWKGRHYCGASLISSRWLLSAAHCF-----------AKKNN 232

  Fly   142 RQDSHVKI--------VDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTP--- 195
            .:|..|..        :.|:|..::.|..||:.....||||::..|.|.....:..:|:|..   
Human   233 SKDWTVNFGIVVNKPYMTRKVQNIIFHENYSSPGLHDDIALVQLAEEVSFTEYIRKICLPEAKMK 297

  Fly   196 -SENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESK-ITDNMICAGYVEQG 258
             |||   ...||||||.|...|.....|||..:.|:..:.| |::|..|. :||.|:|||:: .|
Human   298 LSEN---DNVVVTGWGTLYMNGSFPVILQEDFLKIIDNKIC-NASYAYSGFVTDTMLCAGFM-SG 357

  Fly   259 GKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENT 315
            ..|:||.|||||:....|.:.:.|.||||||:||.|.|.|||||||.|:.:||...|
Human   358 EADACQNDSGGPLAYPDSRNIWHLVGIVSWGDGCGKKNKPGVYTRVTSYRNWITSKT 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 88/241 (37%)
Tryp_SPc 83..314 CDD:238113 90/243 (37%)
TMPRSS11BNP_872308.2 SEA 45..143 CDD:279699 6/22 (27%)
Tryp_SPc 184..410 CDD:214473 88/241 (37%)
Tryp_SPc 185..413 CDD:238113 90/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41415
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.