DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP001365

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_321778.5 Gene:AgaP_AGAP001365 / 1281817 VectorBaseID:AGAP001365 Length:608 Species:Anopheles gambiae


Alignment Length:253 Identity:76/253 - (30%)
Similarity:116/253 - (45%) Gaps:27/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQD 144
            |.||:||..:...|:||.:.:.....:.||.|::..::.||||||:.    |..|...|:.:...
Mosquito   361 RSRIIGGVTSNQGEHPWHVAIYLDEEYQCGGSIIGRRWILTAAHCLT----RQNTNETLDVDLFR 421

  Fly   145 SHVKIVD---------RRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCM---PTPSE 197
            .:..|:|         |....|::|..|:...:.:||.|:|....:.....:.|||:   .....
Mosquito   422 VYTGIIDISTIDDHFYRTADEVIVHRDYNPVMYTTDIGLLRLKRNITYNSFIKPVCLYNRTVDIS 486

  Fly   198 NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC--RNSNYGESKITDNMICAGYVEQGGK 260
            .:.|:...||||| .:..|.||:.|..:|||::||:.|  ||..:..........|||:.:  |.
Mosquito   487 TFYGREGKVTGWG-FNRDGVISNVLNYLEVPVVSQKMCSQRNVQFNGVLAVGESFCAGHAD--GN 548

  Fly   261 DSCQGDSGGPMHVLGSGDAYQLAGIVSWGEG-----CAKPNAPGVYTRVGSFNDWIAE 313
            ..|.|||||.: |...|..|.:.||||....     ...||...|:|.|..|.:||.:
Mosquito   549 SVCNGDSGGGL-VFAEGPRYYVRGIVSISAQRRNLLLCDPNQYSVFTDVSKFLNWIRQ 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 73/247 (30%)
Tryp_SPc 83..314 CDD:238113 74/250 (30%)
AgaP_AGAP001365XP_321778.5 GD_N 42..144 CDD:292649
GD_N 190..297 CDD:292649
Tryp_SPc 363..603 CDD:214473 73/247 (30%)
Tryp_SPc 364..606 CDD:238113 74/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.