DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPA5

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_320729.4 Gene:CLIPA5 / 1280861 VectorBaseID:AGAP011787 Length:397 Species:Anopheles gambiae


Alignment Length:296 Identity:91/296 - (30%)
Similarity:142/296 - (47%) Gaps:32/296 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 QSILGPEVPAEWSSPAKRECAECSCGNINTR---HRIVGGQETEVH--EYPWMIMLMWFG----- 104
            :|:|....|.......:.|....:||..|..   ..:.|.::.|.|  |:|||:.:|...     
Mosquito    92 RSVLDSPPPGVIKPSGRTEQVRPTCGVRNKNGLGFSVTGVKDGESHYGEFPWMVAVMLSSPMDNS 156

  Fly   105 ----NFY-CGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIV--DRRVSRVLIHPK 162
                |.| ||.|::.....|||||||.......:.:|..|.:.|..|...:  :|||:.|::|..
Mosquito   157 DSILNVYQCGGSVIAPNVVLTAAHCVFNKPKTQLLLRAGEWDTQTEHELYMHQNRRVAEVILHEA 221

  Fly   163 YSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWG--ALSEGGPISDTLQEV 225
            :...:..:|:||:...||.:||.::.|:|:|....::..|....:|||  ...:.|.....|::|
Mosquito   222 FDNESLANDVALLTLAEPFQLGENVQPICLPPSGTSFDYQHCFASGWGKDQFGKEGKYQVILKKV 286

  Fly   226 EVPILSQEEC----RNSNYGESKITD-NMICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLA 283
            |:|::...:|    |:...|...:.| :.:|||.|  .|:|.|:||.|.|:  .:.||...|..|
Mosquito   287 ELPVVPHAKCQETMRSQRVGNWFVLDQSFLCAGGV--AGQDMCRGDGGSPLVCPIPGSPTHYYQA 349

  Fly   284 GIVSWGEGCAKPNAPGVYTRVGSFNDWI----AENT 315
            |||:||.||.:...||||..|....|||    .||:
Mosquito   350 GIVAWGLGCGEDGIPGVYGDVAFLRDWIDQQLVENS 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 80/251 (32%)
Tryp_SPc 83..314 CDD:238113 82/257 (32%)
CLIPA5XP_320729.4 Tryp_SPc 135..380 CDD:238113 81/246 (33%)
Tryp_SPc 135..377 CDD:214473 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.