DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPA2

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_320727.4 Gene:CLIPA2 / 1280859 VectorBaseID:AGAP011790 Length:503 Species:Anopheles gambiae


Alignment Length:278 Identity:79/278 - (28%)
Similarity:125/278 - (44%) Gaps:21/278 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PEVPAEWSSPAKRECAECSCGNIN----TRHRIVGGQETEVHEYPWMIMLMWF--GNFYCGASLV 113
            |..||..:.......:...||.:|    .:..|......|..|:|||:.|...  ..:.|..:|:
Mosquito   206 PPTPALTAQFTPESFSYQDCGQLNLNGVVQRTINEDFRAEYGEFPWMVALFQLPEQRYCCNGALI 270

  Fly   114 NDQYALTAAHCVNGFYHRL--ITVRLLEHNRQDSHVKIVDRR---VSRVLIHPKYSTRNFDSDIA 173
            :.:..||.||||.....|.  |.||..|.|...:|...:.|.   |..|..||:||.....::||
Mosquito   271 DPKAILTTAHCVTNCGGRAANIMVRFGEWNMSSTHEMAIPREDIGVKSVHQHPRYSPSALLNNIA 335

  Fly   174 LIRFNEPVRLGIDMHPVCMPTPSENY-AGQTAVVTGWG-ALSEGGPISDTLQEVEV----PILSQ 232
            ::....||:....:.|||:|:.::.. |.:..:.|||| .:.|..|.:..|:.:::    |.:.:
Mosquito   336 VLELAHPVQYQATIQPVCLPSANQPLRAMENMIATGWGRVMEENAPPTQILKRLDLQRMEPSICR 400

  Fly   233 EECRNSNYGESKITDNMICAGYVEQGGKD-SCQGDSGGP--MHVLGSGDAYQLAGIVSWGEGCAK 294
            |..|........|.|:.........|.:: .|.||:|.|  :.:.|:.:.|.|.|:||||.||.:
Mosquito   401 EALRRVRRPYPFILDSSFVCSTTNHGDQERPCDGDAGAPVVVELPGTTNRYYLHGLVSWGYGCHQ 465

  Fly   295 PNAP-GVYTRVGSFNDWI 311
            ...| .|.|:|..|.:||
Mosquito   466 KQIPYTVLTKVVHFREWI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 71/245 (29%)
Tryp_SPc 83..314 CDD:238113 73/246 (30%)
CLIPA2XP_320727.4 Tryp_SPc 244..486 CDD:238113 72/240 (30%)
Tryp_SPc 244..483 CDD:214473 70/238 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.