DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP011794

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_320721.3 Gene:AgaP_AGAP011794 / 1280854 VectorBaseID:AGAP011794 Length:154 Species:Anopheles gambiae


Alignment Length:139 Identity:44/139 - (31%)
Similarity:74/139 - (53%) Gaps:11/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 MHPVCMPTPSENYAGQTAVVTGWG--ALSEGGPISDTLQEVEVPILSQEEC----RNSNYG-ESK 244
            ::.:|:|.....:.....|.:|||  .....|.:...:::||:|::.:..|    |.::.| :.|
Mosquito     4 VNTICLPPADYIFDPVRCVASGWGKDVFGNEGMLQVIMKKVELPLVPRGACQRALRTTHLGRQFK 68

  Fly   245 ITDNMICAGYVEQGGKDSCQGDSGGPM--HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSF 307
            :.::.:|||  .:.|:|:|:||.|.|:  .:.|..:.|..||||:||..|.|...||||..|..|
Mosquito    69 LHESFVCAG--GEKGRDTCKGDGGSPLVCPIPGVANGYYQAGIVAWGIDCGKEGIPGVYVNVALF 131

  Fly   308 NDWIAENTR 316
            .:||.|..|
Mosquito   132 REWIDEQLR 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 40/132 (30%)
Tryp_SPc 83..314 CDD:238113 42/135 (31%)
AgaP_AGAP011794XP_320721.3 Tryp_SPc <2..138 CDD:238113 42/135 (31%)
Tryp_SPc <2..135 CDD:214473 40/132 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.