DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP011908

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_320621.4 Gene:AgaP_AGAP011908 / 1280755 VectorBaseID:AGAP011908 Length:391 Species:Anopheles gambiae


Alignment Length:266 Identity:85/266 - (31%)
Similarity:139/266 - (52%) Gaps:30/266 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 ECSCGNINTRHRIVGGQETEVHEYPWMIMLM--WFGNFYCGASLVNDQYALTAAHCVNGFYHRLI 133
            ||.||...|. :||||....|:||..|:.|:  ...|.:|..::::.:|.||||||.     |.|
Mosquito   143 ECDCGWSRTA-KIVGGSVAGVNEYTAMVGLLDPLTVNVFCSGAIISSRYVLTAAHCA-----RTI 201

  Fly   134 ----TVRLL--EHNRQ---DSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHP 189
                .|:.|  :|:.:   |:....: ..:.:::.|..|:.:..::||||::.:..:.....:.|
Mosquito   202 PSVSRVQALVGDHDYRSGLDTPYSAI-YNIEQIISHEYYNEQTRNNDIALLKTSTEMDFNRGVGP 265

  Fly   190 VCMPTPSENYA--GQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICA 252
            :|:|.....|:  |.:..:.|||..|.|||:|..|::..:.:|     :|:|.....:.|..||.
Mosquito   266 ICLPFTYSTYSFGGLSVDIAGWGTTSFGGPMSTILRKTTLNVL-----QNANCTAPYVNDQKICT 325

  Fly   253 GYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRD 317
            ..|   |:||||.||||.:.:.||...|.: ||:|:|..|| .:.|.|.|||.::..||.:||.:
Mosquito   326 FAV---GRDSCQYDSGGALFLRGSQRMYSI-GIISYGSACA-ASTPSVATRVTAYLSWIRQNTPE 385

  Fly   318 ACSCAQ 323
            ...||:
Mosquito   386 VSYCAK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 74/241 (31%)
Tryp_SPc 83..314 CDD:238113 76/243 (31%)
AgaP_AGAP011908XP_320621.4 CUB 26..>106 CDD:294042
Tryp_SPc 153..379 CDD:214473 74/241 (31%)
Tryp_SPc 154..382 CDD:238113 76/243 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.