DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:269 Identity:83/269 - (30%)
Similarity:127/269 - (47%) Gaps:39/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVG-GQETEVHEYPWMIML--MWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITV 135
            ||  .||.:::. ||....:.:|||.:|  ....:..||.||::|::.|||||||.. ..|....
Mosquito     1 CG--VTRVQLIAYGQPARAYAFPWMALLETSVSDDLPCGGSLISDRHILTAAHCVKA-RKRDCDD 62

  Fly   136 RLLEHNRQDSHVKIVDRR------------------VSRVLIHPKYSTRNFDSDIALIRFNEPVR 182
            |:  |.:.|.:.......                  :..::.|||||.|:..:|:|:||...|..
Mosquito    63 RI--HFKDDEYDSGESEEADGAEYSASCGPPAQRIPIETIVTHPKYSARSKRNDLAIIRLQYPAI 125

  Fly   183 LGIDMHPVCMPTPSE--NYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKI 245
            :|.::.|:|:|...:  .|....:.||||| |:|.|..|..|:...:|.|...:|..    ..|.
Mosquito   126 IGYNVIPICLPLTEQLRAYRPADSFVTGWG-LTETGQRSAVLRYAILPALPLPDCAM----RIKE 185

  Fly   246 TDNMICA--GYVEQGGKD---SCQGDSGGPMHVLGSGDAYQLAGIVSWG-EGCAKPNAPGVYTRV 304
            .|.:|..  |::..||.:   .|.||||||:..:.....:.|.|:||:| :.|....||||:..|
Mosquito   186 LDRIIVLDDGHLCAGGNNRTAHCHGDSGGPLQYVSDSTRFVLQGVVSFGVKTCGTKIAPGVFANV 250

  Fly   305 GSFNDWIAE 313
            ..|.|||.:
Mosquito   251 THFIDWIVQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 77/257 (30%)
Tryp_SPc 83..314 CDD:238113 79/260 (30%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 77/255 (30%)
Tryp_SPc 9..257 CDD:238113 77/255 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.