DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP008861

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_319603.2 Gene:AgaP_AGAP008861 / 1279828 VectorBaseID:AGAP008861 Length:259 Species:Anopheles gambiae


Alignment Length:240 Identity:88/240 - (36%)
Similarity:129/240 - (53%) Gaps:18/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQD 144
            |.:||||...::.|.|:.|.|...|:..||.|:::..:.||||||:.|.....:::      |..
Mosquito    28 RAQIVGGFPIDISEAPYQISLREGGHPSCGGSIISPDWILTAAHCLEGVSADQVSI------RAG 86

  Fly   145 SHVKI---VDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRL-GIDMHPVCMPTPSEN--YAGQT 203
            |..|:   |.|.|:||::||.:.....:.||||:....|:.| |..|..:.||...|.  ..|..
Mosquito    87 STYKMHGGVLRNVARVVLHPAWDPVTNEGDIALMELESPLPLDGDTMASIEMPEQDEEDPVEGSK 151

  Fly   204 AVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSG 268
            |:|:|||........:..|:...:||:.::.|:.:......|::.|:|||:.| ||.||||||||
Mosquito   152 ALVSGWGKTLNRFHSALILRATFLPIVHRDNCQKAYRRTHTISEMMLCAGFFE-GGHDSCQGDSG 215

  Fly   269 GPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAE 313
            ||:.|   .|.  |.|:||:..|||:|..|||..||.:..|||.|
Mosquito   216 GPLVV---DDV--LVGVVSFAIGCARPGLPGVNARVSAVRDWIRE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/234 (36%)
Tryp_SPc 83..314 CDD:238113 87/237 (37%)
AgaP_AGAP008861XP_319603.2 Tryp_SPc 31..256 CDD:238113 87/237 (37%)
Tryp_SPc 31..253 CDD:214473 84/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.