DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP011477

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_317829.4 Gene:AgaP_AGAP011477 / 1278364 VectorBaseID:AGAP011477 Length:276 Species:Anopheles gambiae


Alignment Length:260 Identity:93/260 - (35%)
Similarity:135/260 - (51%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVN 126
            |||.||....|..|.||.. |:|||.:|.:..:|:.:.|.......||.:::|....|||||||:
Mosquito    32 SSPIKRTSPICKYGLINMA-RVVGGSDTTIEAHPYQVSLRRLHKHSCGGAILNTNTILTAAHCVD 95

  Fly   127 GFYHRLI----TVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDM 187
              |..|:    .||.....|.:....|.   |:::..||.|:....:.||::::....::|...:
Mosquito    96 --YPELVPSDFEVRAGSTFRNEGGQLIT---VAQIHTHPSYNDWTLEWDISVLKLVSSLQLSPTV 155

  Fly   188 HPVCMPTPSENYAGQTAV-VTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMIC 251
            .|:.:|.........|:| :.|||:|...||.::.||.|.:||:|...|..:....:.|....||
Mosquito   156 QPISLPDRGLTIPDGTSVSLAGWGSLYYQGPSTNHLQHVMLPIVSNSRCGMAYKNFAPILPFHIC 220

  Fly   252 AGYVEQGGKDSCQGDSGGPMHVLGSGDAYQ--LAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAEN 314
            ||:   .|||:||||||||:       .||  :.||||||.|||..|.|.|||||..|.|:|.::
Mosquito   221 AGH---KGKDACQGDSGGPL-------VYQSRVVGIVSWGYGCAFENYPSVYTRVSEFLDFIGQH 275

  Fly   315  314
            Mosquito   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 83/235 (35%)
Tryp_SPc 83..314 CDD:238113 83/237 (35%)
AgaP_AGAP011477XP_317829.4 Tryp_SPc 51..272 CDD:214473 83/235 (35%)
Tryp_SPc 52..272 CDD:238113 82/234 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.