DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP006539

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_316577.4 Gene:AgaP_AGAP006539 / 1277138 VectorBaseID:AGAP006539 Length:270 Species:Anopheles gambiae


Alignment Length:285 Identity:91/285 - (31%)
Similarity:142/285 - (49%) Gaps:31/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 QSSFLDWIQSILGPEVPAEWSSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMW-FGN 105
            |:.:|....::||..:    :.||.|.......|   ...|||.|.:..:.:||:|:.|.. .|.
Mosquito     2 QTKYLTISFALLGVAL----AIPASRSTIVDESG---PDRRIVNGTDASILDYPFMLSLRGSTGG 59

  Fly   106 FYCGASLVNDQYALTAAHCVNGFYHRLITVRL----LEHNRQDSHVKIVDRRVSRVLIHPKYSTR 166
            ..||.|::::.:|:||||||:.....|.|:::    :..:..||...|     ::|:.||:|.:|
Mosquito    60 HSCGGSILSELWAMTAAHCVSSTTTYLQTIQVGRTNISRDVDDSVYGI-----AQVIAHPQYDSR 119

  Fly   167 NFD-SDIALIRFNEPVRLGIDMHPVCMPTP----SENYAGQTAVVTGWGALSEGGPISDTLQEVE 226
            |.. :||||::...|:.....:.||.:|.|    .::.......:.|||.|:.||....|||.|:
Mosquito   120 NSHLNDIALLKLQRPIVFSESVQPVRLPAPMFEVEDDLDDLGVTLIGWGLLATGGSAPATLQRVD 184

  Fly   227 VPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWG-E 290
            ..::..|||...:.|  .|..:.|||. :..|||..|.||||||:  |..|   ...|||||. :
Mosquito   185 YYVVPNEECNAIHTG--TIYPSHICAA-IPGGGKGQCSGDSGGPL--LHHG---VQVGIVSWSVK 241

  Fly   291 GCAKPNAPGVYTRVGSFNDWIAENT 315
            .||....|||.|:|....::|.::|
Mosquito   242 PCAVAPYPGVLTKVSHHLEFIQQHT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 81/239 (34%)
Tryp_SPc 83..314 CDD:238113 81/241 (34%)
AgaP_AGAP006539XP_316577.4 Tryp_SPc 35..262 CDD:214473 81/239 (34%)
Tryp_SPc 36..265 CDD:238113 81/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.