DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP006192

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_316257.4 Gene:AgaP_AGAP006192 / 1276857 VectorBaseID:AGAP006192 Length:346 Species:Anopheles gambiae


Alignment Length:323 Identity:83/323 - (25%)
Similarity:132/323 - (40%) Gaps:64/323 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHR--IVGGQETEVHEYPWMIML-----MWFGNFYCGASLVNDQYALTAAHCVNGFYHR 131
            ||.:....:  |.||..:....:||.:.:     :...::.||.:::|....|||.|||      
Mosquito    26 CGQVQVLKQGLIFGGTASTPGMWPWHVAVFHRESIRRTSYKCGGTIINRDTVLTAYHCV------ 84

  Fly   132 LITVRLLEHNRQDSHVKIVDR----------------RVSRVLIHPKYSTRNFDSDIALIRFNEP 180
                  :|:.|..:..::|.|                ||..|:..|..|.|.||.|||:::....
Mosquito    85 ------VENQRPIAAGRLVARAGLFDLDVGGPTVQENRVFDVISPPGASARTFDDDIAILKMQTQ 143

  Fly   181 VRLGIDMHPVCMPTPSEN---YAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNS--NY 240
            ......:.|||:.:..::   ..|....|.||| .:|....|..|::..||::|.|:|..|  |.
Mosquito   144 FTYDDYVQPVCIRSVRQDIGQLVGAYGTVVGWG-WTEQSTTSAELRQANVPVVSAEDCLASDRNL 207

  Fly   241 GESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGV----- 300
            ....:|..:.|||  .:.|..||.|||||.|....|| .:.|.|:.|:....||.:  |:     
Mosquito   208 FSQVLTTKVYCAG--SRNGTSSCNGDSGGGMFFRMSG-YWFLRGLTSFSAVDAKQS--GICDSHG 267

  Fly   301 ---YTRVGSFNDWIAE-NTRDACSCAQPEAAGEPASPMETTEQGDQENTTANGAAEADPEVEE 359
               ||.|..:.||:.| ..|......:|....:|.         ..:.:||......||:.::
Mosquito   268 YVGYTDVAKYLDWLREQGVRYEDPLQRPGTVSKPV---------PSDGSTALLRLAVDPKTKK 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 72/264 (27%)
Tryp_SPc 83..314 CDD:238113 74/265 (28%)
AgaP_AGAP006192XP_316257.4 Tryp_SPc 37..284 CDD:238113 73/264 (28%)
Tryp_SPc 37..280 CDD:214473 71/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.