DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005791

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_315804.4 Gene:AgaP_AGAP005791 / 1276457 VectorBaseID:AGAP005791 Length:248 Species:Anopheles gambiae


Alignment Length:260 Identity:47/260 - (18%)
Similarity:93/260 - (35%) Gaps:72/260 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VGGQETEVHEYPWMI-MLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHV 147
            :||.:..:.:||::. :|:.........::::..:.||:|..|              ::..||..
Mosquito    21 IGGTDVSIAQYPFVAGILLQRSTIIGNGAILSPNWVLTSASAV--------------YSTPDSDY 71

  Fly   148 KI-----------VDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAG 201
            .|           ...:|.|:..||::.  .:|.::||::.:..:..|..:..:.:.|.......
Mosquito    72 SIATGSEELLTPAAQYQVQRIFRHPEFV--GWDYNVALVKVSGKIAFGDTVQSIAIATTDPETVN 134

  Fly   202 QTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQ--------- 257
            . |.:..:|...:|                ....|::.|  :.|:||..|...:::         
Mosquito   135 D-ATMLSYGKNEDG----------------TSHLRSATY--TLISDNDDCVPLLQEYQAKEVIWQ 180

  Fly   258 ---------GGKDSCQ--GDSGGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
                     .|....|  .|:|.|:...|     ||..:.::.|.....|...|.||:.||..||
Mosquito   181 HHGFCLIPPPGTQQGQWYNDAGAPLVADG-----QLYAVFAFAENEGGTNEGSVATRLTSFAGWI 240

  Fly   312  311
            Mosquito   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 45/258 (17%)
Tryp_SPc 83..314 CDD:238113 47/260 (18%)
AgaP_AGAP005791XP_315804.4 Tryp_SPc 21..243 CDD:304450 47/260 (18%)
Tryp_SPc 21..240 CDD:214473 45/258 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.