DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005591

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_315601.4 Gene:AgaP_AGAP005591 / 1276277 VectorBaseID:AGAP005591 Length:273 Species:Anopheles gambiae


Alignment Length:219 Identity:53/219 - (24%)
Similarity:86/219 - (39%) Gaps:35/219 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FYCGASLVNDQYALTAAHCVNG---FYHRLITVRLLEHNRQ-DSHVKIVDRRVSRVLIHPKYSTR 166
            :.|..||:...|.||.|.|||.   .|...|...|...|.: :.|:.|.   ::.:.|||. |:.
Mosquito    67 YTCAGSLITPVYILTTAACVNHNSVEYAFAILGSLFNGNTEWEQHINIT---MNGIRIHPP-SSM 127

  Fly   167 NFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILS 231
            ...:|||.|..:.|..|...:.|:.:|..|:....:....|...||:     .|.|:.:...::|
Mosquito   128 YGHNDIATIHMDHPATLNEYVQPIRLPRLSDTRTYEMMEGTATSALN-----GDGLRYLRNQVMS 187

  Fly   232 QEECRNSNYGESKITDNMICAG-YVEQGGKDSCQGDSGGPMHV--------LGSGDAYQLAGIVS 287
            ..:|..:......|:...||.. |:   |...|...:|..:.|        :|.|:...|..:  
Mosquito   188 NADCHEAIQPLYNISSQHICTDTYI---GGSLCGRTTGSALTVEDENGRMLVGVGNLIVLCDL-- 247

  Fly   288 WGEGCAKPNAPGVYTRVGSFNDWI 311
                    :.|..:.||..|.:||
Mosquito   248 --------HYPIRHIRVSYFREWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 51/217 (24%)
Tryp_SPc 83..314 CDD:238113 53/219 (24%)
AgaP_AGAP005591XP_315601.4 Tryp_SPc 42..264 CDD:238113 53/219 (24%)
Tryp_SPc 42..263 CDD:214473 51/217 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.