DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005310

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_315325.4 Gene:AgaP_AGAP005310 / 1276024 VectorBaseID:AGAP005310 Length:256 Species:Anopheles gambiae


Alignment Length:289 Identity:71/289 - (24%)
Similarity:108/289 - (37%) Gaps:74/289 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 AECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCV--------- 125
            |..|..:.|...|:..|.:....::|:.:.:.......||..:|::::.||||||.         
Mosquito    12 AVVSIAHANVVGRVADGSDARRGQFPYQVAMTLKRQTVCGGVMVHERFFLTAAHCFFKGETPLPL 76

  Fly   126 --------------NGFYHRLITVRLLEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIR 176
                          ||.|:|:.||..  |.:.|...| .|..|..|       .|.||    |..
Mosquito    77 EQLNVFYGSEKLFSNGRYNRVKTVHF--HEQYDHGTK-YDLAVVEV-------KRKFD----LTS 127

  Fly   177 FNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYG 241
            .:.||..|.:..       .||.   .|.|||:|..:..|.::..|:..::..|...:||.: .|
Mosquito   128 ASRPVEFGQEAF-------GENL---LATVTGYGRNTVEGNMAFRLKYAQLTSLPDSQCREA-MG 181

  Fly   242 ESKITDNMICAGYVEQGGKDSCQGDSGGPM----HVLGSGDAYQLAGIVSWGEGCAKPNAPGVYT 302
            |. ..:.:.|..  ...|...|.||.|||.    .::|.| :|.:.|....|       .|.|:.
Mosquito   182 ED-YYEGVFCLD--TSAGAGFCLGDYGGPAVFEDRLVGVG-SYTVGGKCEAG-------LPDVFV 235

  Fly   303 RVGSFNDWIAENTRDACSCAQPEAAGEPA 331
            .||.|::|:           |.....|||
Mosquito   236 DVGHFSEWV-----------QSVLEAEPA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 63/255 (25%)
Tryp_SPc 83..314 CDD:238113 63/257 (25%)
AgaP_AGAP005310XP_315325.4 Tryp_SPc 21..247 CDD:238113 65/272 (24%)
Tryp_SPc 24..244 CDD:214473 63/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.