DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPE5

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_314516.3 Gene:CLIPE5 / 1275278 VectorBaseID:AGAP010547 Length:373 Species:Anopheles gambiae


Alignment Length:273 Identity:62/273 - (22%)
Similarity:108/273 - (39%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SSPAKRECAECSCGNINTRHRIVGGQETEVHEYPWMIMLMWFG----------NFYCGASLVNDQ 116
            |:|::.|.....||....:.|....|:.|..: |..:.|..|.          .|.|.|.|::..
Mosquito   122 SNPSEIEREFNECGQRYVQLRKQRQQQWEGFQ-PLRLRLPHFAEVGWEEGSEIRFQCIAYLISTS 185

  Fly   117 YALTAAHCVNGFYHRLITVRL--LEHNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNE 179
            ..:|:|.|:.........|||  :....|.:::.|:.  :|.|.|||:::...|:::|||::...
Mosquito   186 AVVTSASCLVSKEFEPTVVRLGNIRSGPQTTNIAIIP--ISTVEIHPEFNQSTFENNIALLKLTL 248

  Fly   180 PVRLGIDMHPVCM-----PTPSENYAGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSN 239
            ||:..:.|.|.|:     .:|.|:            |:..||...|.:..:.|     .:| |..
Mosquito   249 PVQPTVYMFPGCLWQNKTHSPVES------------AIFRGGNGFDPIHPMYV-----RDC-NVR 295

  Fly   240 YGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGD----AYQLAGIVSWGEGCAKPNAPGV 300
            :..:.....:.|......|..:.|. .:|.|:....:.|    ...|..|.|.|. |...:...|
Mosquito   296 FARTFSDPRITCMVPGVYGTGEHCY-PTGSPIIFRQNEDTNLFTEYLVNIYSHGR-CNSTSLRIV 358

  Fly   301 YTRVGSFNDWIAE 313
            : |:..:.||..|
Mosquito   359 H-RIAMYIDWFKE 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 55/249 (22%)
Tryp_SPc 83..314 CDD:238113 56/252 (22%)
CLIPE5XP_314516.3 Tryp_SPc 174..>261 CDD:304450 25/88 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.