DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:239 Identity:67/239 - (28%)
Similarity:111/239 - (46%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 NFYCGASLVNDQYALTAAHCV---NGFYHRLITVRLLE-----HNRQDSHVKIVDRRVSRVLIHP 161
            :|.||.||:..::.||||||.   :|...:::.:.:::     ::.|:...:  :..:|....||
Mosquito    14 SFDCGGSLITPRHVLTAAHCALNDDGVAPQVVRLGVIDITAGLYDPQNQFAQ--EYGISSFRRHP 76

  Fly   162 KYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTAVVTGWGALSEGGPISDTLQEVE 226
            ::..|....||.|:..:.||.|...:.|.|:.|.::....:...| |:|..|.||..:..|.:|:
Mosquito    77 EHEFRAEYHDIGLVTLDRPVTLTDAVVPACLWTGAQVPLRRLEAV-GFGQTSFGGERTPILLKVQ 140

  Fly   227 VPILSQEEC-------RNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPMHVLGSGDAYQL-- 282
            :..:....|       |....|   :.|..:||   .....|:|.||||||:.:....:...:  
Mosquito   141 LSPVDNSACGRFYPPSRRRRQG---LIDQQMCA---SDERMDTCHGDSGGPLQLKLMANNRLIPF 199

  Fly   283 -AGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTR---DACSCA 322
             .||.|:|..|... .|.|||||.|:.||:...|.   ||.:||
Mosquito   200 VVGITSFGRFCGTA-TPAVYTRVSSYVDWLQTETGVSFDAKACA 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 61/223 (27%)
Tryp_SPc 83..314 CDD:238113 62/226 (27%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 62/224 (28%)
Tryp_SPc 1..227 CDD:214473 60/222 (27%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.