DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP005196

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_314095.2 Gene:AgaP_AGAP005196 / 1274902 VectorBaseID:AGAP005196 Length:264 Species:Anopheles gambiae


Alignment Length:238 Identity:65/238 - (27%)
Similarity:107/238 - (44%) Gaps:23/238 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWFGN-FYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSH 146
            |:||.:.|..:.|::..|::..: .|||.|::..::.|||||||.......:||..:..|  |::
Mosquito    35 IIGGTDVEDGKAPYLAGLVYNNSATYCGGSIIAARWILTAAHCVTNVNVTNLTVVRVGTN--DNY 97

  Fly   147 VKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRL-----GIDMHPVCMPTPSENYAGQTAVV 206
            ......::.||:.|.:||...|.:|:||:|...|::.     .|:::...:|      ...|..:
Mosquito    98 EGGSMYQIDRVIPHERYSAITFRNDVALLRLKTPIKFEEHVEKIELNEELVP------INATLTI 156

  Fly   207 TGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGGPM 271
            .|||.:..........|.::|..:....||....| |.|....:|.  ..:.|...|:||||.| 
Mosquito   157 VGWGFVGWNKENPKRTQVIKVQHIGLNRCRKMANG-SAIYPEHLCT--FSRAGHGPCKGDSGSP- 217

  Fly   272 HVLGSGDAYQLAGIVSWG-EGCAKPNAPGVYTRVGSFNDWIAE 313
             |:..|   :..|:|||. .|......|.|...:..|..||.:
Mosquito   218 -VVWKG---KQVGVVSWAMAGVCAIGLPDVQASIRYFYGWITK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 63/234 (27%)
Tryp_SPc 83..314 CDD:238113 65/238 (27%)
AgaP_AGAP005196XP_314095.2 Tryp_SPc 35..257 CDD:238113 65/238 (27%)
Tryp_SPc 35..254 CDD:214473 63/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.