DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP004570

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_313874.5 Gene:AgaP_AGAP004570 / 1274709 VectorBaseID:AGAP004570 Length:259 Species:Anopheles gambiae


Alignment Length:251 Identity:107/251 - (42%)
Similarity:155/251 - (61%) Gaps:5/251 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 CGNINTRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLL 138
            ||..|...|||||:.|.|::|||:..|::.|.|:|||||:...|.|||||||.......|.|.|.
Mosquito    13 CGAANQEIRIVGGRPTGVNQYPWLARLVYDGQFHCGASLLTKDYVLTAAHCVRRLKRNKIRVILG 77

  Fly   139 EHNR-QDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQ 202
            :::: ..|....:.|.|:.::.|..:...:::.||||::..:||.....:.|||:|......|||
Mosquito    78 DYDQFVASETPAIMRAVTAIIRHRSFDQNSYNHDIALLKLRKPVEFTKTIRPVCLPKERSEPAGQ 142

  Fly   203 TAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDS 267
            ...|.|||..||||.:...:|.|:||||:.::||:..|..|:||.||:|||   :|.:|||||||
Mosquito   143 LGTVVGWGRTSEGGTLPALVQHVDVPILTLDQCRSMKYRASRITSNMLCAG---KGKQDSCQGDS 204

  Fly   268 GGPMHVLGSGDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCAQ 323
            |||: ::.:||.:::.||||||.||.:...|||||||..:..|:..|..|.|.|::
Mosquito   205 GGPL-LVRNGDKHEIVGIVSWGVGCGRAGYPGVYTRVARYLPWLRANLDDTCLCSK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 99/229 (43%)
Tryp_SPc 83..314 CDD:238113 99/231 (43%)
AgaP_AGAP004570XP_313874.5 Tryp_SPc 21..246 CDD:214473 99/228 (43%)
Tryp_SPc 22..250 CDD:238113 99/231 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D19085at50557
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.