DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and AgaP_AGAP004552

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_313850.5 Gene:AgaP_AGAP004552 / 1274693 VectorBaseID:AGAP004552 Length:349 Species:Anopheles gambiae


Alignment Length:314 Identity:123/314 - (39%)
Similarity:175/314 - (55%) Gaps:23/314 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PEKILNNLAQLRQSSF-------------------LDWIQSILGPEVPAEWSSPAKRECAECSCG 75
            ||..::|..:|.:..|                   :|||..::|..|.|..||...:.|..|.||
Mosquito    38 PEDYVSNEYELEEERFVNFVTVRPEYFEINRARPIIDWITGVIGAPVFASDSSGPSQNCTPCKCG 102

  Fly    76 NIN-TRHRIVGGQETEVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLE 139
            ::. ...|||||...|.:.:.||..|.:...|.||.||::|:|.:|||||.......|..|:...
Mosquito   103 SVEPINERIVGGIPVEDNSFSWMAALYYDNKFCCGGSLLSDRYVITAAHCTTKPDRGLFRVQFGI 167

  Fly   140 HNRQDSHVKIVDRRVSRVLIHPKYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENYAGQTA 204
            ::|.......::|.|.|:|.: .|:..|.::||||:....||.:...:.|:|:|..:|.|.|...
Mosquito   168 NDRSKPIATSIERSVKRILTN-WYNAFNNNNDIALLELTYPVAISDRVMPICLPQATEMYEGSRG 231

  Fly   205 VVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGDSGG 269
            :|||||....||.:|.||.:.|||||:..|||.:.|...:||:.|:||||:| ||||||||||||
Mosquito   232 IVTGWGRTKAGGGLSGTLMQTEVPILTNRECRRAGYWAFQITNKMLCAGYLE-GGKDSCQGDSGG 295

  Fly   270 PMHVLGS-GDAYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWIAENTRDACSCA 322
            |:.||.: .:.|:|.|:||||..||:.|.||||.||..:..||..|.:|:|.|:
Mosquito   296 PLQVLNTKSNHYELVGVVSWGRACAQKNFPGVYARVSQYLYWINRNIKDSCLCS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 100/229 (44%)
Tryp_SPc 83..314 CDD:238113 101/231 (44%)
AgaP_AGAP004552XP_313850.5 Tryp_SPc 110..338 CDD:214473 100/229 (44%)
Tryp_SPc 111..341 CDD:238113 101/231 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ04
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D380103at33208
OrthoFinder 1 1.000 - - FOG0001240
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.