DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18735 and CLIPC3

DIOPT Version :9

Sequence 1:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_313589.2 Gene:CLIPC3 / 1274461 VectorBaseID:AGAP004318 Length:393 Species:Anopheles gambiae


Alignment Length:248 Identity:86/248 - (34%)
Similarity:128/248 - (51%) Gaps:25/248 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVGGQETEVHEYPWMIMLMWFG-----NFYCGASLVNDQYALTAAHC----VNGFYHRLITVRLL 138
            ||||..|:..|:|.|..:.|..     :|.||.||:::.|.||||||    .:|....:  |||.
Mosquito   146 IVGGNVTKPGEFPHMAAIGWRQPNGGYSFDCGGSLISEYYVLTAAHCYAESADGTLPSI--VRLG 208

  Fly   139 EHN--RQDSHVKIVDRRVSRVLIHP--KYSTRNFDSDIALIRFNEPVRLGIDMHPVCMPTPSENY 199
            |.:  |:|...:..:..:.|.::||  |.|...: :|||||:..|.|.....:.|.|: .|||..
Mosquito   209 EQSLVREDDGAEPENYDILRFIVHPDLKRSVGKY-NDIALIQLTERVIFTNFIRPACL-YPSEVL 271

  Fly   200 AGQTAVVTGWGALSEGGPISDTLQEVEVPILSQEEC----RNSNYGESKITDNMICAGYVEQGGK 260
            ..:||:.||:|.....|..||.|::|.:.|.:.|.|    |...:....|....:|.|.: .|||
Mosquito   272 NVRTAIATGFGRTEYLGAKSDELRKVALNIYNNELCAERYRYDRHLRQGILSTQMCVGDL-AGGK 335

  Fly   261 DSCQGDSGGPMHVLGSGD--AYQLAGIVSWGEGCAKPNAPGVYTRVGSFNDWI 311
            |:||||||||:.|....:  .:.:.|:.|.|:.|.. :.|.:||:|..:.|||
Mosquito   336 DTCQGDSGGPLQVTVQENHCMFYILGVTSLGQVCGS-STPAIYTKVHPYLDWI 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 84/246 (34%)
Tryp_SPc 83..314 CDD:238113 86/248 (35%)
CLIPC3XP_313589.2 Tryp_SPc 146..390 CDD:238113 86/248 (35%)
Tryp_SPc 146..387 CDD:214473 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.